Chicken Whole Blood
Kingfisher Biotech Inc Rabbit CTLA-4 Recombinant Protein
The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA
Kingfisher Biotech Inc Feline CCL7 Recombinant Protein
The Feline CCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL7 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: QPEGINSPTTCCYRFTVRKIPIQKLKSYRRITSSYCPREAVIFKTKQAKELCADPKQKWVQDFMEYLDKKTQTSKL (76)) (Gene ID: 101096931). For research use only. Made in the USA
Kingfisher Biotech Inc Mouse CXCL7 Recombinant Protein
The Mouse CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse CXCL7 Specifications: (Molecular Weight: 8.1 kDa) (Amino Acid Sequence: KSDGMDPYIE LRCRCTNTIS GIPFNSISLV NVYRPGVHCA DVEVIATLKN GQKTCLDPNA PGVKRIVMKI LEGY (74)) (Gene ID: 57349). For research use only. Made in the USA
Kingfisher Biotech Inc Mouse CCL6 Recombinant Protein
The Mouse CCL6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse CCL6 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse CCL6 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse CCL6 Specifications: (Molecular Weight: 10.7 kDa) (Amino Acid Sequence: GLIQEMEKED RRYNPPIIHQ GFQDTSSDCC FSYATQIPCK RFIYYFPTSG GCIKPGIIFI SRRGTQVCAD PSDRRVQRCL STLKQGPRSG NKVIA (95)) (Gene ID: 20305). For research use only. Made in the USA
Kingfisher Biotech Inc Rabbit IL-36 alpha Recombinant Protein
The Rabbit IL-36 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IL-36 alpha applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit IL-36 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IL-36 alpha Specifications: (Molecular Weight: 18.3 kDa) (Amino Acid Sequence: STPAPVLRHI QDLNHQVWVV QDQTLTAVPR KHSMVPATVS LIPCQYPETL ETEKGIPMYL GLDKPDVCLF CTKTREQPML QLEDKNIMTL YHHPEPVKPF LFYHSKSGRT STFESVAFPG WFIAVCSEGG CPLFLTQDLG KAYTTDFELT PVN (153)) (Gene ID: 100355520). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey IL-16 Recombinant Protein
The Cynomolgus Monkey IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey IL-16 Specifications: (Molecular Weight: 13.4 kDa) (Amino Acid Sequence: PDLNSTTDSA ASASAASDVS VESSAEATVY TVTLEKMSAG LGFSLEGGKG SLHGDKPLTI NRIFKGAASE QSETIQPGDE ILQLAGTAMQ GLTRFEAWNI IKALPDGPVT TVIRRKSLQP KETTAAADS (129)) (Gene ID: 574100). For research use only. Made in the USA
Kingfisher Biotech Inc Dolphin CCL17 Recombinant Protein
The Dolphin CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Dolphin CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Dolphin CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Dolphin CCL17 Specifications: (Molecular Weight: 9.1 kDa) (Amino Acid Sequence: ARATNVGWEC CWEYFKGAIP FRKLVRWYRT PEDCPRDAIV LVTLHGRSIC SDPKDRWVKK AVKYLQNTTK SCDLAAQPA (79)) (Gene ID: 101325821). For research use only. Made in the USA
Kingfisher Biotech Inc Cynomolgus Monkey CXCL1 Recombinant Protein
The Cynomolgus Monkey CXCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL1 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: ASVVTELRCQ CLQTLQGIHP KNIQSVNVKA PGPHCAETEV IATLKNGQKA CLNPASPMVQ KIIKKMLNCD KSN (73)) (Gene ID: 574222). For research use only. Made in the USA
Kingfisher Biotech Inc Feline CCL7 Recombinant Protein
The Feline CCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL7 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: QPEGINSPTTCCYRFTVRKIPIQKLKSYRRITSSYCPREAVIFKTKQAKELCADPKQKWVQDFMEYLDKKTQTSKL (76)) (Gene ID: 101096931). For research use only. Made in the USA
ACROBiosystems GMP Human IL-6 Protein
GMP Human IL-6 Protein (GMP-L06H27) is expressed from human 293 cells (HEK293). It contains AA Val 30 - Met 212 (Accession # P05231).
ACROBiosystems Human LILRB4 2Vials
Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4) is also known as CD85 antigen-like family member K (CD85K) Immunoglobulin-like transcript 3 (ILT-3) Leukocyte immunoglobulin-like receptor 5 (LIR-5) Monocyte inhibitory receptor HM18 which belongs to the leukocyte immunoglobulin-like receptor (LIR) family. LILRB4 / CD85K contains 2 Ig-like C2-type (immunoglobulin-like) domains. CD85K is detected in monocytes macrophages dendritic cells lung natural killer cells and B-cells. LILRB4 / CD85K is receptor for class I MHC antigens. CD85K recognizes a broad spectrum of HLA-A HLA-B HLA-C and HLA-G alleles involved in the down-regulation of the immune response and the development of tolerance. LILRB4 interferes with TNFRSF5-signaling and NF-kappa-B up-regulation and inhibits receptor-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
ACROBiosystems Human CD19 2Vials
Chimeric antigen receptors (CARs) comprise interact domains of which target cancer cell expressed antigens and allow T cell to efficiently kill the cancer cell. FMC63 is an IgG2a mouse monoclonal antibody specific for CD19 which is a target for the immunotherapy of B lineage leukaemias and lymphomas. FMC63 scFv is the most commonly used ectodomain component of CD19-specific CARs. Our CAR-like cells apply the HEK293 cells for the expression of FMC63 which will be presented on the cell membrane. It mimics the real CAR-T cell reaction and it is used as positive control for Anti-CD19 scFv Antibody flow cytometry detection.
ACROBiosystems Human LRRC15 2Vials
LRRC15 (Leucine-rich repeat-containing protein 15) is also known as LIB and hLib. LRRC15 is highly expressed in a variety of solid tumors. LRRC15 was expressed on stromal fibroblasts in many solid tumors (e.g. breast head and neck lung pancreatic) as well as directly on a subset of cancer cells of mesenchymal origin (e.g. sarcoma melanoma glioblastoma). LRRC15 expression was induced by TGFβ on activated fibroblasts (αSMA+) and on mesenchymal stem cells. These collective findings suggested LRRC15 as a novel CAF and mesenchymal marker with utility as a therapeutic target for the treatment of cancers with LRRC15-positive stromal desmoplasia or cancers of mesenchymal origin. ABBV-085 is a monomethyl auristatin E (MMAE)-containing antibody–drug conjugate (ADC) directed against LRRC15 and it demonstrated robust preclinical efficacy against LRRC15 stromal-positive/cancer-negative and LRRC15 cancer-positive models as a monotherapy or in combination with standard-of-care therapies.
ACROBiosystems Human APP 2Vials
Amyloid precursor protein (APP) is a type I integral membrane protein ubiquitously expressed in many tissues and concentrated in the synapses of neurons. It has three predominant splice variants: APP695 APP751 and APP770. The majority of APP is cleaved at the plasma membrane by the α-secretase in the non-amyloidogenic pathway. The amyloidogenic pathway starts with β-secretase cleavage by BACE1 on the N-terminal part of the Aβ domain releasing sAPPβ from a membrane-anchored fragment named βCTF or C99 which is subsequently cleaved by γ-secretase to release Aβ.
ACROBiosystems Human LY6G6D 2Vials
LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction.